BUPATI  TANAH  BUMBU

PROVINSI KALIMANTAN SELATAN

PERATURAN BUPATI TANAH BUMBU

NOMOR   TAHUN  2017

 

TENTANG

 

TUGAS, FUNGSI, URAIAN TUGAS DAN  TATA KERJAUNSUR-UNSURORGANISASIDINAS KOMUNIKASI DAN INFORMATIKA

DENGAN RAHMAT TUHAN YANG MAHA ESA

BUPATI TANAH BUMBU,

 

 

Menimbang          : a.  bahwa sebagai tindak lanjut pelaksanaan Peraturan Daerah Kabupaten Tanah Bumbu Nomor 19Tahun 2016 tentang Pembentukan dan Susunan Perangkat Daerah, perlu menyusuntugas, fungsi, uraian tugas dan tata kerja unsur-unsur organisasi Dinas Komunikasi dan Informatika dalam bentuk Peraturan Bupati;

 

  1. bahwa berdasarkan pertimbangan sebagaimana dimaksud dalam huruf a, perlu menetapkan Peraturan Bupati tentang Tugas, Fungsi, Uraian Tugas dan Tata Kerja Unsur-unsur Organisasi Dinas Komunikasi dan Informatika.

 

Mengingat            : 1.  Undang-Undang Nomor 2 Tahun 2003 tentang Pembentukan Kabupaten Tanah Bumbu dan Kabupaten Balangan di Propinsi Kalimantan Selatan (Lembaran Negara Republik Indonesia Tahun 2003 Nomor 22, Tambahan Lembaran Negara Republik Indonesia Nomor 4265);

 

  1. Undang-UndangNomor 14 Tahun 2008 tentangKeterbukaanInformasiPublik (Lembaran Negara Republik Indonesia Tahun tahun 2008 Nomor 61, Tambahan Lembaran Negara Republik Indonesia Nomor 4868);
  2. Undang-Undang Nomor 12 Tahun 2011 tentang Pembentukan Peraturan Perundang-undangan (Lembaran Negara Republik Indonesia Tahun 2011 Nomor 82, Tambahan Lembaran Negara Republik Indonesia Nomor 5234);
  3. Undang-Undang Nomor 5 Tahun 2014 tentang AparaturSipil Negara (Lembaran Negara Republik Indonesia Tahun 2014 Nomor 6, Tambahan Lembaran Negara Republik Indonesia Nomor 5494);
  4. Undang-UndangNomor 23 Tahun 2014 tentangPemerintahan Daerah (Lembaran Negara Republik Indonesia Tahun 2014 Nomor 244, TambahanLembaran Negara Republik Indonesia Nomor 5587) sebagaimanatelahdiubahbeberapa kali terakhirdenganUndang-UndangNomor 9 Tahun 2015 tentangPerubahanKeduaAtasUndang-UndangNomor 23 Tahun 2014 tentangPemerintahan Daerah (Lembaran Negara Republik Indonesia Tahun 2015 Nomor 58, TambahanLembaran Negara Republik Indonesia Nomor 5679);
  5. PeraturanPemerintahNomor18 Tahun 2016 tentangOrganisasiPerangkat Daerah (Lembaran Negara Republik Indonesia Tahun 2016 Nomor 114, TambahanLembaran Negara Republik Indonesia Nomor 5887);
  6. Peraturan Menteri Dalam Negeri Nomor 80 Tahun 2015tentang Pembentukan Produk Hukum Daerah (Berita Negara Republik Indonesia Tahun 2015 Nomor 2036);
  7. Peraturan Menteri Komunikasi dan Informatika Republik Indonesia Nomor 14 Tahun 2016 tentang Pedoman Nomenklatur Perangkat Daerah Bidang Komunikasi dan Informatika (Berita Negara Republik Indonesia Tahun 2016 Nomor 1308);
  8. Peraturan Kepala Lembaga Sandi Negara Nomor Tahun 2016 tentang Nomenklatur Perangkat Daerah dan Unit Kerja Pada Perangkat Daerah Urusan Pemerintahan Bidang Persandian (Berita Negara Republik Indonesia Tahun 2016 Nomor 1314);
  9. Peraturan Daerah Kabupaten Tanah Bumbu Nomor 19 Tahun 2016 tentang Pembentukan dan Susunan Perangkat Daerah (Lembaran Daerah Kabupaten Tanah Bumbu Tahun 2016 Nomor 19);
  10. Peraturan Bupati Kabupaten Tanah Bumbu Nomor 29 Tahun 2016 tentang Kedudukan, Tugas, Fungsi dan Susunan Organisasi Perangkat Daerah (Berita Daerah Kabupaten Tanah Bumbu Tahun 2016 Nomor 29).

 

MEMUTUSKAN  :

 

Menetapkan      :    PERATURAN BUPATI TENTANG TUGAS, FUNGSI, URAIAN TUGAS DAN TATA KERJA UNSUR-UNSUR ORGANISASI DINASKOMUNIKASI DAN INFORMATIKA.

 

 

 

BAB  I

KETENTUAN  UMUM

Pasal 1

 

Dalam Peraturan ini yang dimaksud dengan :

  1. Daerah adalahKabupaten Tanah Bumbu.
  2. PemerintahKabupatenadalahPemerintahKabupaten Tanah Bumbu.
  3. BupatiadalahBupati Tanah Bumbu.
  4. Sekretaris Daerah adalahSekretaris DaerahKabupaten Tanah Bumbu.
  5. DinasKomunikasi dan Informatikayang selanjutnya disingkat Dinas adalah Dinas Komunikasi dan InformatikaKabupaten Tanah Bumbu.
  6. Kepala Dinasadalah Kepala Dinas Komunikasi dan Informatika.
  7. Sekretariat dan Kepala Bidang adalah Sekretariat dan Kepala Bidang  pada Dinas Komunikasi dan Informatika.
  8. Sekretaris dan Kepala Bidang adalah Sekretaris dan Kepala Bidang pada Dinas Komunikasi dan Informatika.
  9. Sub Bagian dan Seksi adalah Sub bagian dan Seksi pada Dinas Komunikasi dan Informatika.
  10. Kepala Sub Bagian dan Kepala Seksi adalah Kepala Sub bagian dan Kepala Seksi pada Dinas Komunikasi dan Informatika.
  11. Kelompok Jabatan fungsional adalah Kelompok Jabatan fungsional pada Dinas Komunikasi dan Informatika.
  12. Unit Pelaksana Teknis Dinas adalah Unit Pelaksana Teknis Dinas Komunikasi dan Informatika.

 

BAB II

 

TUGAS, FUNGSI, URAIAN TUGAS DAN TATA KERJA UNSUR-UNSUR ORGANISASI DINAS KOMUNIKASI DAN INFORMATIKA

 

Bagian Pertama

Dinas Komunikasi dan Informatika

 

Pasal 2

 

(1)   DinasKomunikasidanInformatika mempunyai tugas membantu Bupati dalam melaksanakan penyusunan dan pelaksanaan kebijakan daerah di bidang komunikasidaninformatika, persandiandanstatistik.

 

(2)   Dinas dalam melaksanakan tugas sebagaimana dimaksud pada ayat (1) menyelenggarakan fungsi:

  1. perumusan kebijakan daerah dibidang komunikasi dan informatika, persandian dan statistik;
  2. pelaksanaan kebijakan daerah dibidang komunikasi dan informatika, persandian dan statistik;
  3. pelaksanaan evaluasi dan pelaporan dibidang komunikasi dan informatika, persandian dan statistik;
  4. pelaksanaan administrasi Dinas; dan
  5. pelaksanaan fungsi lain yang diberikan oleh Bupati terkait dengan tugas dan fungsinya.

 

(3)   Dalam menjabarkan tugas dan fungsi sebagaimana dimaksud pada ayat (1) dan (2), Dinasmempunyai uraian tugas sebagai berikut:

  1. merumuskan kebijakan teknis dibidangkomunikasi dan informatika, persandian dan statistiksesuai dengan kebijakan yang ditetapkan oleh Bupati berdasarkan peraturan perundang-undangan yang berlaku;
  2. menetapkan kebijakan teknis dibidangkomunikasi dan informatika, persandian dan statistik;
  3. melaksanakan kebijakan, pembinaan, pengendalian, pengawasandan pengaturan serta penyelenggaraan kegiatan dibidang pengelolaan dan komunikasi publik;
  4. melaksanakan kebijakan, pembinaan, pengendalian, pengawasandan pengaturan serta penyelenggaraan kegiatan dibidang penyelenggaraan e–Government;
  5. melaksanakan kebijakan, pembinaan, pengendalian, pengawasandan pengaturan serta penyelenggaraan kegiatan dibidangstatistik dan persandian;
  6. melaksanakan koordinasi dengan instansi yang terkait;
  7. mengendalikan pengelolaan kegiatan ketatausahaan;
  8. mengoordinasikan pelaksanaan kegiatan jabatan fungsional;
  9. membina dan mengoordinasikan pengelolaan Unit Pelaksana Teknis Daerah;
  10. mengevaluasi dan melaporkan pelaksanaan tugas; dan
  11. melaksanakan tugas lain yang diberikan oleh Bupatisesuai bidang tugas.

 

Pasal 3

 

Unsur-unsur Organisasi Dinas Komunikasi dan Informatika terdiri dari:

  1. Sekretariat;
  2. Bidang Pengelolaan dan Komunikasi Publik;
  3. Bidang Penyelenggaraan e-Government;
  4. BidangStatistikdanPersandian;
  5. Unit Pelaksana Teknis; dan
  6. Kelompok Jabatan Fungsional.

 

 

 

 

 

 

 

Bagian Kedua

Sekretariat

 

Pasal 4

 

(1)   Sekretariat mempunyai tugas menyelenggarakankoordinasi pelaksanaan tugas, pembinaandan pemberian dukungan administrasi kepada seluruh unit organisasi.

 

(2)   Sekretariat dalam melaksanakan tugas sebagaimana dimaksud pada ayat (1) menyelenggarakan fungsi:

  1. koordinasi kegiatan perencanaan, pelaksanaan, evaluasi dan pelaporan;
  2. penyusunan rencana, program kerja dan anggaran;
  3. pembinaan dan pemberian dukungan administrasi yang meliputi ketatausahaan, kepegawaian, keuangan, kerumahtanggaan, perlengkapan, kerjasama, hubungan masyarakat dan kearsipan;
  4. pembinaan organisasi dan tata laksana dinas;
  5. koordinasi dan penyusunan peraturan perundang-undangan;
  6. penyelenggaraan pengelolaan barang milik daerah/negara;
  7. pengelolaan kegiatan pemantauan, evaluasi, dokumentasi dan pelaporan;
  8. pengumpulan, pengelolaan data dan teknologi informasi;
  9. koordinasi penyelesaian tindak lanjut hasil pemeriksaan;
  10. pelaksanaan tugas lain yang diberikan oleh atasan sesuai bidang tugas.

 

(3)   Untuk menjabarkan tugas dan fungsi sebagaimana tersebut pada ayat (1) dan (2), Sekretariat mempunyai uraian tugas sebagai berikut:

  1. melaksanakan koordinasi kegiatan dengan unit kerja dilingkungan Dinas;
  2. melaksanakan penyusunan rencana, program kerja dan anggaran Dinas;
  3. menyelenggarakan pelaksanaan urusan tata laksana keuangan;
  4. melaksanakan urusan perbendaharaan dan gaji;
  5. melaksanakan urusan verifikasi dan akuntansi keuangan;
  6. melakukan penyusunan laporan keuangan;
  7. menyiapkan bahan dan pelaksanaan urusan kepegawaian;
  8. menyiapkan bahan pembinaan pegawai;
  9. menyiapkan bahan dan pelaksanaan urusan ketatausahaan dan kearsipan;
  10. menyiapkan bahan dan pelaksanaan urusan rumahtangga dan perlengkapan;
  1. menyiapkan bahan dan pelaksanaan urusan kerja sama dan kehumasan;
  2. melaksanakan pengelolaan dan inventarisasi barang milik daerah/negara;
  3. melaksanakan layanan pengadaan Dinas;
    1. melaksanakan pembinaan organisasi dan tata laksana Dinas;
    2. melaksanakan koordinasi dan penyusunan peraturan perundang-undangan;
    3. menghimpun dan menyiapkan bahan penyusunan laporan;
    4. menyelenggarakan pengelolaan kegiatan dokumentasi dan informasi;
    5. melaksanakan pengumpulan, pengelolaan data dan penyelenggaraan urusan teknologi informasi;
    6. menyiapkan bahan kooardinasi dengan instansi terkait;
    7. melaksanakan evaluasi dan pelaporan pelaksanaan tugas;
    8. melaksanakan tugas lain yang diberikan oleh atasan  sesuai bidang tugas;

 

Pasal 5

 

Sekretariat terdiri dari:

  1. Sub BagianUmumdanKepegawaian;
  2. Sub BagianPerencanaan, KeuangandanPelaporan;

 

Pasal 6

 

(1)   Sub Bagian Umum dan Kepegawaian mempunyai tugas melaksanakan kegiatan pengelolaan urusan ketatausahaan, persuratan, kearsipan, rumahtangga, perlengkapan, kepegawaian, organisasi, kehumasan dan pengelolaan barang milik daerah/negara.

 

(2)   Untuk menjabarkan tugas pokok sebagaimana dimaksud pada ayat (1), Sub Bagian Umum dan Kepegawaian mempunyai uraian tugas sebagai berikut:

  1. menyiapkan bahan dan melaksanakan urusan tata usaha;
  2. menyiapkan bahan dan melaksanakan urusan rumah tangga;
  3. menyiapkan bahan dan menyusun rencana kebutuhan barang unit dan rencana tahunan barang unit (RKBU dan RTBU);
  4. melaksanakan layanan pengadaan Dinas;
  5. melaksanakan penataan administrasi pendistribusian sarana alat kantor dan keperluan alat kantor terhadap unsur-unsur unit organisasi;
  6. menyiapkan bahan dan melaksanakan pengelolaan, inventarisasi, pemeliharaan, penghapusan serta penyusunan laporan barang milik daerah/negara;
  7. melaksanakan pengelolaan urusan keamanan dan kebersihan lingkungan kantor;
  8. menyiapkan bahan dan melaksanakan urusan tata persuratan dan kerasipan;
  9. menyiapkan bahan dalam rangka pemantauan pelaksanaan tata naskah dan tata kearsipan agar diperoleh surat menyurat dan kearsipan/dokumentasi yang benar, tertib dan rapi sesuai dengan petunjuk dan ketentuan yang berlaku;
  10. melakukan penyimpanan, pemilahan, pemindahan dan penjadualan retensi serta pemusnahan arsip;
  11. melaksanakan pelayanan administrasi perjalanan dinas, akomodasi tamu, kehumasan dan keprotokolan serta kerjasama;
  12. menyiapkan bahan pembinaan pegawai, meliputi pembinaan disiplin, pengawasan melekat, kesejahteraan, pemberian tanda jasa/ penghargaan dan kedudukan hukum pegawai;
  13. melaksanakan penataan administrasi kepegawaian yang meliputi bazzeting, formasi, DUK, data pegawai, pengarsipan berkas pegawai dan rekapitulasi absensi pegawai;
  14. menghimpun bahan usulan mutasi kepegawaian, meliputi pengusulan, kepangkatan dalam jabatan, kenaikan pangkat, kenaikan gaji berkala, pemindahan, pemberhentian dan pensiun;
  15. menyiapkan bahan penyampaian Laporan Harta Kekayaan Penyelenggara Negara (LHKPN) dan Laporan Harta Kekayaan Aparatur Sipil Negara (LHKSN);
  16. menyiapkan bahan pembinaan organisasi dan tata laksana Dinas;
  17. melaksanakan evaluasi dan pelaporan pelaksanaan tugas; dan
  18. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugas.

 

Pasal  7

 

(1)   Sub Bagian Perencanaan, Keuangan dan Pelaporan mempunyai tugas melaksanakan penyusunan rencana, program kerja, anggaran, keuangan, pengelolaan data dan informasi publik, pendokumentasian, koordinasi penyusunan peraturan perundang-undangan serta pelaporan Dinas.

 

(2)   Untuk menjabarkan tugas pokok sebagaimana dimaksud pada ayat (1), Sub Bagian Perencanaan, Keuangan dan Pelaporan mempunyai uraian tugas sebagai berikut:

  1. menghimpun, menyiapkan bahan dan menyusun program dan rencana kerja dinas;
  2. menghimpun, menyiapkan bahan dan menyusun rencana strategis;
  3. menyusun rencana anggaran bulanan/triwulan dinas;
  4. menghimpun, menyiapkan bahan dan menyusun rencana kegiatan dan anggaran (RKA) dan penyusunan anggaran pendapatan belanja daerah (APBD) dan anggaran belanja negara;
  5. menghimpun, menyiapkan bahan dan menyusun rencana anggaran tidak langsung dinas;
  6. menyiapkan bahan dan mengelola administrasi pembayaran belanja dinas;
  7. melakukan pengelolaan pembayaran gaji pegawai dan keperluan/kebutuhan kantor;
  8. menyiapkan dan menyusun laporan keuangan dan memelihara pengarsipan administrasi keuangan;
  9. melaksanakan penatausahaan penetapan pejabat perbendaharaan;
  10. menyusun rencana dan melaksanakan kegiatan pengumpulan, pengelolaan, analisa dan penyajian data;
  11. menyelenggarakan pemanfaatan teknologi informasi;
  12. menyelenggarakan dan mengelola pengamanan data dan informasi;
  13. melaksanakan pengelolaan dan pelayanan informasi publik;
  14. menghimpun dan menyiapkan bahan penyusunan laporan akuntabilitas dinas, laporan penyelenggaraan pemerintahan daerah dan laporan-laporan kedinasan lainnya;
  15. menghimpun dan menyiapkan bahan untuk mendokumentasikan hasil kegiatan administrasi keuangan, kepegawaian maupun kegiatan masing-masing bidang;
  16. menyiapkan bahan koordinasi dan penyusunan peraturan perundang-undangan;
  17. menyiapkan bahan dalam rangka penyusunan laporan untuk disampaikan kepada satuan kerja yang membutuhkan laporan pengembangan kinerja Dinas;
  18. menyiapkan bahan koordinasi penyelesaian tindak lanjut hasil pemeriksaan;
  19. melaksanakan evaluasi dan pelaporan pelaksanaan tugas; dan
  20. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugas.

 

Bagian Ketiga

Bidang Pengelolaan dan Komunikasi Publik

 

Pasal 8

 

(1)   Bidang Pengelolaan dan Komunikasi Publik mempunyai tugas melakukan penyiapanperumusankebijakanteknisdan penyelenggaraan kegiatan di bidang pengelolaan dan komunikasi publik.

 

  • Bidang Pengelolaan dan Komunikasi Publik dalam melaksanakan tugas sebagaimana dimaksud pada ayat (1) menyelenggarakan fungsi:
  1. penyiapan perumusan kebijakan dibidang pengelolaan dan komunikasi publik;
  2. pelaksanaan kebijakan dibidang pengelolaan aspirasi dan produksi informasi;
  3. pelaksanaan kebijakan dibidang pengelolaan saluran komunikasi publik dan kemitraan;
  4. pelayanan informasi publik dan penyediaan akses informasi di daerah;
  5. koordinasi penyelenggaraan kegiatan;
  6. evaluasi dan pelaporan; dan
  7. pelaksanaan fungsi lain yang diberikan oleh atasan.

 

(3)   Untuk menjabarkan tugas dan fungsi sebagaimana tersebut pada ayat (1) dan (2),Bidang Pengelolaan dan Komunikasi Publik mempunyai uraian tugas sebagai berikut:

  1. menyiapkanbahanpenyusunanrumusankebijakandaerah di bidangpengelolaan dan komunikasi publik;
  2. melaksanakankebijakan di bidangpengelolaan dan komunikasi publik;
  3. menyiapkanbahanpenyusunannorma, standar, prosedurdankriteriasertapemberianbimbinganteknis di bidangpengelolaandankomunikasipublik;
  4. menyelenggarakan pengelolaan opini dan aspirasi publik;
  5. menyelenggarakan pengelolaan informasi untuk mendukung kebijakan nasional dan pemerintah daerah;
  6. melaksanakan penyediaan konten lintas sektoral dan pengelolaan media komunikasi publik;
  7. melaksanakan pelayanan informasi publik;
  8. melaksanakan layanan hubungan media;
  9. melaksanakan penguatan kapasitas sumber daya komunikasi publik;
  10. melaksanakan penyediaan akses informasi;
  11. melaksanakan koordinasi dengan instansi terkait;
  12. melaksanakanpemantauan, evaluasi dan pelaporan pelaksanaan tugas; dan
  13. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugasnya.

 

Pasal 9

 

Bidang Pengelolaan dan Komunikasi Publik terdiri dari:

  1. Seksi Pengelolaan Aspirasi dan Produksi Informasi; dan
  2. Seksi Pengelolaan Saluran Komunikasi Publik dan Kemitraan;

 

Pasal 10

 

(1)   Seksi Pengelolaan Aspirasi dan Produksi Informasimempunyai tugas menyiapkan bahan penyusunan program, petunjuk teknis dan pengoordinasian penyelenggaraan kegiatan di bidang pengelolaan aspirasi dan produksi informasi.

 

(2)   Untuk menjabarkan tugas sebagaimana tersebut pada ayat (1),Seksi Pengelolaan Aspirasi dan Produksi Informasi mempunyai uraian tugas sebagai berikut:

  1. menyiapkan bahan penyusunan program penyelenggaraan kegiatan dibidang pengelolaan aspirasi dan produksi informasi;
  2. menyiapkan bahan pembinaan dan petunjuk teknis kegiatan di bidang pengelolaan aspirasi dan produksi informasi;
  3. menyelenggarakan layanan monitoring isu publik di media baik media massa maupun sosial;
  4. melaksanakan pengumpulan pendapat umum melalui survei, jejak pendapat dan sebagainya;
  5. melaksanakan pengolahan dan layanan aduan masyarakat;
  6. menyelenggarakan standarisasi pertukaran informasi untuk database informasi lintas sektoral;
  7. pemantauan tema komunikasi publik lintas sektoral lingkup nasional dan pemerintah daerah;
  8. melaksanakan pengolahan dan analisis data informasi untuk mendukung komunikasi publik lintas sektoral lingkup nasional dan daerah;
  9. melaksanakan pelayanan informasi publik dalam rangka implementasi peraturan tentang keterbukaan informasi publik;
  10. menyelenggarakan layanan perencanaan komunikasi publik dan citra positif pemerintah daerah;
  11. melaksankan pengemasan ulang konten nasional menjadi konten lokal;
  12. melaksanakan pembuatan konten lokal;
  13. melaksanakan penyiapan koordinasi dengan instansi terkait;
  14. melaksanakan evaluasi dan pelaporan pelaksanaan tugas; dan
  15. melaksanakan tugas lain yang diberikan oleh atasan sesuai bidang tugas.

 

Pasal 11

 

  • (1) Seksi Pengelolaan Saluran Komunikasi Publik dan Kemitraan mempunyai tugas menyiapkan bahan penyusunan program, petunjuk teknis dan pengoordinasian penyelenggaraan kegiatan di bidang pengelolaan saluran komunikasi publik dan kemitraan.

 

  • (2) Untuk menjabarkan tugas pokok sebagaimana tersebut pada ayat (1),Seksi Pengelolaan Saluran Komunikasi Publik dan Kemitraan mempunyai uraian tugas sebagai berikut:
  1. menyiapkan bahan penyusunan program penyelenggaraan kegiatan di bidang pengelolaan saluran komunikasi publik dan kemitraan;
  2. menyiapkan bahan pembinaan dan penyusunan petunjuk teknis dibidang pengelolaan saluran komunikasi publik dan kemitraan;
  3. menyiapkan bahan pengelolaan saluran komunikasi milik pemerintah daerah/media internal;
  4. melaksanakan diseminasi informasi kebijakan melalui media pemerintah daerah dan non pemerintah daerah;
  5. melaksanakan pemberdayaan dan penyediaan akses informasi bagi media dan lembaga komunikasi publik;
  6. melaksanakan penyelenggaraan dan koordinasi pertunjukan media tradisional;(akan ditentukan kemudian berkoordinasi dengan pariwisata dan kesenian)
  7. menyiapkan bahan pengembangan sumber daya komunikasi publik di daerah;
  8. menyelenggarakan pengelolaan hubungan kemitraan dengan media (media relations);
  9. menyelenggarakan penyediaan bahan komunikasi bagi pimpinan daerah dan perangkat daerah (briefing notes, press release, backgrounders);
  10. melaksanakan penyiapan koordinasi dengan instansi terkait;
  11. melaksanakan evaluasi dan pelaporan pelaksanaan tugas; dan
  12. melaksanakan tugas lain yang diberikan oleh atasan sesuai bidang tugas.

 

Bagian Empat

Bidang Penyelenggaraan e-Government

 

Pasal 12

 

(1)    Bidang Penyelenggaraan e-Governmentmempunyai tugas penyiapanperumusankebijakanteknisdan penyelenggaraan kegiatan di bidang penyelenggaraan e-Government.

.

(2)   Bidang Penyelenggaraan e-Governmentdalam melaksanakan tugas sebagaimana dimaksud pada ayat (1) menyelenggarakan fungsi:

  1. penyiapan perumusan kebijakan dibidang penyelenggaraan e-Government;
  2. pelaksanaan kebijakan,pemberian bimbingan teknis, supervisi dan pemantauan di bidang pengembangan dan pengelolaan data aplikasi;
  3. pelaksanaan kebijakan,pemberian bimbingan teknis, supervisi dan pemantauan di bidang infrastruktur, telekomunikasi dan layanan e-Government;
  4. koordinasi penyelenggaraan kegiatan;
  5. evaluasi dan pelaporan; dan
  6. pelaksanaan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugasnya.

 

(3)   Untuk menjabarkan tugas dan fungsi sebagaimana tersebut pada ayat (1) dan (2),Bidang Penyelenggaraan e-Governmentmempunyai uraian tugas sebagai berikut:

  1. menyiapkan bahan perumusan kebijakandibidang penyelenggaraan e-Government;
  2. melaksanakan pemberian bimbingan teknis, supervisi dan pemantauan dibidang penyelenggaraan e-Government;
  3. menyelenggarakan layanan infrasturktur dasar data center, disaster recovery center dan TIK;
  4. menyelenggarakan layanan pengembangan intranet dan penggunaan akses internet;
  5. melaksanakan layanan sistem komunikasi intra pemerintah daerah;
  6. melaksanakan layanan keamanan informasi e-Government;
  7. melaksanakan layanan manajemen data dan informasi e-Government;
  8. melaksanakan layanan pengembangan dan pengelolaan aplikasi generik dan spesifik dan suplemen yang terintegrasi;
  9. mengintegrasikan layanan publik dan kepemerintahan;
  10. menyelenggarakan ekosistem TIK Smart City;
  11. melaksanakan penyelenggaraan Goverment Chief Information Officer (GCIO) pemerintah;
  12. melaksanakan pengembangan sumber daya TIK pemerintah dan masyarakat;
  13. melaksanakan layanan nama domain dan sub domain bagi lembaga, pelayanan publik dan kegiatan daerah;
  14. melaksanakan pemeliharaan infrastruktur sistem komunikasi pemerintah daerah;
  15. melaksanakan koordinasi dengan instansi terkait;
  16. melaksanakan evaluasi dan pelaporan; dan
  17. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugas.

 

Pasal 13

 

Bidang Penyelenggaraan e-Governmentterdiri dari :

  1. SeksiPengembangandanPengelolaan Data Aplikasi;
  2. SeksiInfrastruktur, Telekomunikasi danLayanane-Government;

 

Pasal 14

 

  • Seksi Pengembangan dan Pengelolaan Data Aplikasi mempunyai tugas menyiapkan bahan penyusunan program, petunjuk teknis dan pengoordinasian penyelenggaraan kegiatan di bidang pengembangan dan pengelolaan data aplikasi.

 

  • Untuk menjabarkan tugas sebagaimana tersebut pada ayat (1),Seksi Pengembangan dan Pengelolaan Data Aplikasimempunyai uraian tugas sebagai berikut:
  1. melakukan penyiapan bahan penyusunan program di bidang pengembangan dan pengelolaan data aplikasi;
  2. menyiapkan bahan dan melaksanakan penyusunan petunjuk teknis kegiatan di bidang pengembangan dan pengelolaan data aplikasi;
  3. menyiapkanbahanpenetapanstandar format data daninformasi;
  4. melaksanakanlayananrecovery data daninformasi;
  5. melaksanakanlayanan,pengembangandanpengelolaanaplikasipemerintahandanpelayanan public yang terintegrasi;
  6. melaksanakankajianteknispenetapanfasilitasposdantelekomunikasi; tambahan
  7. layananpemeliharaanaplikasikepemerintahanandan public;
  8. melaksanakanlayananinterkonektivitaslayanan public dankepemerintahanan;
  9. menyelenggarakanekosistem TIKsmart city;
  10. melaksanakanlayananinteraktifpemerintahdanmasyarakat;
  11. melaksanakanlayananpeningkatankapasitassumberdaya TIK pemerintahdanmasyarakat;
  12. menyiapkanbahanlayanannama domain dan sub domain bagilembaga,pelayananpublikdankegiatandaerah;
  13. menyiapkanbahanpemberianbimbinganteknis, supervisidanpemantauan di bidangpengembangandanpengelolaan data aplikasi;
  14. melaksanakanevaluasidanpelaporanpelaksanaantugas;dan
  15. melaksanankantugas lain yang diberikanolehatasansesuaidenganbidangtugas.

Pasal 15

 

(1)    Seksi Infrastruktur, Telekomunikasi danLayanane-Governmentmempunyai tugas menyiapkan bahan penyusunan program, petunjuk teknis dan pengoordinasian penyelenggaraan kegiatan di bidanginfrastruktur, telekomunikasidanlayanane–Government.

 

(2)    Untuk menjabarkan tugas sebagaimana tersebut pada ayat (1),Seksi Infrastruktur, Telekomunikasi Dan Layanane–Governmentmempunyai uraian tugas sebagai berikut:

  1. melakukan penyiapan bahan penyusunan program di bidang infrastruktur, telekomunikasidanlayanane–Government;`
  2. menyiapkan bahan dan melaksanakan penyusunan petunjuk teknis kegiatan di bidang infrastruktur, telekomunikasidanlayanane–Government;
  3. menyiapkanbahanlayananinfrastrukturdasar data center, disaster recovery center dan TIK;
  4. menyiapkanbahanpengembangan intranet danpenggunaanakses internet pemerintahdaerahdanpublik;
  5. menyiapkanbahanlayanansistemkomunikasi intra pemerintahdaerah;
  6. menyiapkanbahanpemeliharaaninfrastruktursistemkomunikasipemerintahdaerah;
  7. menyelenggarakanlayanankeamananinformasie-government;
  8. melaksanakanpelayananpembinaan, pengendaliandanpengawasanterhadapperizinan yang terkaitdenganinfrastrukturposdantelekomunikasi; tambahan
  9. menyelenggarakanlayanan filtering kontennegatif;pindahkekasiaplikasi
  10. melaksanakanpenyelenggaraan internet sehat, kreatif, inovatifdanproduktif;pindahkekasiaplikasi
  11. menyiapkanbahanbimbinganteknis, supervisidanpemantauandalampemanfaatansistemkomunikasiolehaparaturpemerintah;
  12. menyelenggarakanlayananpenyelenggaraanGovernment Chief Information Officer(CGIO) pemerintahdaerah;
  13. menyiapkanbahankoordinasidenganinstansiterkait:
  14. melaksanakanevaluasidanpelaporanpelaksanaantugas; dan
  15. melaksanankantugas lain yang diberikanolehatasansesuaidenganbidangtugas.

 

 

Bagian Kelima

Bidang Statistik dan Persandian

 

Pasal 16

 

  • Bidang Statistik dan Persandian mempunyai tugas penyiapanperumusankebijakanteknisdan penyelenggaraan kegiatan di bidangstatistik dan persandian.

 

  • Bidang Statistik dan Persandian dalam melaksanakan tugas sebagaimana dimaksud pada ayat (1) menyelenggarakan fungsi:
    1. penyiapan perumusan kebijakan di bidang statistik dan persandian;
    2. pelaksanaan kebijakan dan penyelenggaraan kegiatan di bidang statistik sektoral di lingkup daerah;
    3. pelaksanaan kebijakan dan penyelenggaraan persandian untuk pengamanan informasi pemerintah daerah;
    4. koordinasi penyelenggaraan kegiatan;
    5. evaluasi dan pelaporan; dan
    6. pelaksanaan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugasnya.

 

  • Untuk menjabarkan tugas dan fungsi sebagaimana tersebut pada ayat (1) dan (2), Bidang Statistik dan Persandianmempunyai uraian tugas sebagai berikut:
    1. menyiapkan bahan perumusan kebijakan di bidang statistik dan persandian;
    2. menyiapkan bahan dan melaksanakan penyusunan petunjuk teknis penyelenggaraan statistik sektoral di daerah;
    3. menyiapkan bahan dan melaksanakan penyusunan peraturan teknis tata kelola persandian, operasional pengelolaan komunikasi sandi dan operasional pengamanan komunikasi sandi antar perangkat daerah;
    4. melaksanakan survey bidang sosial, ekonomi, politik, hukum dan HAM yang telah mendapatkan rekomendasi dari BPS;
    5. menghimpun data dan membuat kompilasi statistik sektoral di bidang sosial, ekonomi, politik, hukum dan HAM yang telah mendapatkan rekomendasi BPS;
    6. melaksanakan pengelolaan informasi berklasifikasi dan proses pengamanan informasi pemerintah daerah;
    7. melaksanakan pengukuran tingkat kerawanan dan keamanan informasi;
    8. menyusun rencana kebutuhan sumber daya manusia sandi, perangkat lunak persandian dan perangkat keras persandian dalam rangka operasional komunikasi sandi antar perangkat daerah;
    9. menyusun rencana dan melaksanakan pemeliharaan dan perbaikan terhadap perangkat lunak, perangkat keras dan jaring komunikasi sandi;
    10. melaksanakan bimbingan teknis pengembangan kompetensi sumber daya manusiasandi;
    11. merancang dan menetapkan pola hubungan komunikasi sandi antar perangkat daerah;
    12. melaksanakan pengamanan terhadap aset/fasilitas/instalasi vital melaui kontra penginderaan dan/atau metode pengamanan sandi lainnya;
    13. melaksanakan pengawasan terhadap pengelolaan informasi berklasifikasi, pengelolaan sumber daya persandian, operasional pengelolaan komunikasi sandi dan operasional pengamanan komunikasi sandi;
    14. melaksanakan koordinasi dengan instansi terkait;
    15. melaksanakan evaluasi dan pelaporan kegiatan; dan
    16. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugas.

 

Pasal 17

 

Bidang Statistik dan Persandian terdiri dari:

  1. SeksiStatistik;
  2. SeksiPersandian;

 

Pasal 18

 

(1)   Seksi Statistikmempunyai tugas menyiapkan bahan penyusunan program, petunjuk teknis dan pengoordinasian penyelenggaraan kegiatan dibidang statistik.

 

(2)   Untuk menjabarkan tugas sebagaimana tersebut pada ayat (1),Seksi Statistikmempunyai uraian tugas sebagai berikut:

  1. melakukan penyiapan bahan penyusunan program di bidang statistik;
  2. menyiapkan bahan dan melaksanakan penyusunan petunjuk teknis kegiatan di bidang statistik;
  3. melakukan penyiapan dokumen dan bahan yang diperlukan untuk kegiatan pengumpulan statistik di bidang sosial, ekonomi, politik, hukum dan HAM;
  4. melaksanakan survey statistik di bidang sosial, ekonomi, politik, hukum dan HAM yang telah mendapatkan rekomendasi BPS;
  5. melakukan penyiapan dokumen dan bahan yang diperlukan untuk kegiatan penyusunan kompilasi produk administrasi bidang sosial, ekonomi, politik, hukum dan HAM;
  6. melaksanakan penyusunan kompilasi produk administrasi bidang sosial, ekonomi, politik, hukum dan HAM yang mendapat rekomendasi BPS;
  7. menghimpun, mengolah dan menyajikan data statistik kewenangan daerah;
  8. melaksanakan upaya-upaya pengembangan kompetensi sumber daya manusia di bidang statistik;
  9. menyiapkan bahan koordinasi dengan instansi terkait;
  10. melaksanakan evaluasi dan pelaporan pelaksanaan tugas; dan
  11. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugas.

 

Pasal 19

 

(1)   Seksi Persandianmempunyai tugas menyiapkan bahan penyusunan program, petunjuk teknis dan pengoordinasian penyelenggaraan kegiatandibidang persandian.

 

(2)   Untuk menjabarkan tugas sebagaimana tersebut pada ayat (1),Seksi Persandian mempunyai uraian tugas sebagai berikut:

  1. melakukan penyiapan bahan penyusunan program di bidang persandian;
  2. menyiapkan bahan penyusunan peraturan teknis tata kelola persandian, operasional pengelolaan komunikasi sandi dan operasional pengamanan komunikasi sandi antar perangkat daerah;
  3. menyiapkan bahan pelaksanaan pengelolaan informasi berklasifikasi dan proses pengamanan informasi pemerintah daerah;
  4. menyiapkan bahan pengukuran tingkat kerawanan dan keamanan informasi;
  5. menyiapkan bahan penyusunan rencana kebutuhan sumber daya manusia sandi, perangkat lunak persandian dan perangkat keras persandian dalam rangka operasional komunikasi sandi antar perangkat daerah;
  6. menyiapkan perencanaan dan pelaksanaan pemeliharaan dan perbaikan terhadap perangkat lunak, perangkat keras dan jaring komunikasi sandi;
  7. menyiapkan bahan rancangan pola hubungan komunikasi sandi antar perangkat daerah;
  8. menyiapkan bahan pelaksanaan pengamanan terhadap aset/fasilitas/instalasi vital sistem persandian;
  9. menyiapkan bahan pengawasan terhadap pengelolaan informasi berklasifikasi, pengelolaan sumber daya persandian, operasional pengelolaan komunikasi sandi dan operasional pengamanan komunikasi sandi;
  10. menyiapkan bahan pelaksanaan bimbingan teknis pengembangan kompetensi sumber daya manusia sandi;
  11. menyiapkan bahan koordinasi dengan instansi terkait;
  12. melaksanakan evalusi dan pelaporan kegiatan; dan
  13. melaksanakan tugas lain yang diberikan oleh atasan sesuai dengan bidang tugas.

 

 

Bagian Keenam

Unit Pelaksana Teknis

 

Pasal 20

 

Unit Pelaksana Teknis mempunyai tugas melaksanakan kegiatan teknis operasional dan atau kegiatan teknis penunjang tertentu.

 

 

Bagian Ketujuh

Kelompok Jabatan Fungsional

 

Pasal 21

 

Kelompok Jabatan Fungsional mempunyai tugas melaksanakan sebagian tugas dinas sesuai dengan keahlian dan fungsinya.

 

 

BAB  III

TATA KERJA

 

Pasal 22

 

  • Dinas Daerah dipimpin oleh seorang Kepala Dinas yang berada di bawah dan bertanggung jawab kepada Bupati melalui sekretaris daerah;
  • Sekretariat dipimpin oleh seorang Sekretaris yang berada di bawah dan bertanggung jawab kepada Kepala Dinas;
  • Masing-masing bidang dipimpin oleh seorang kepala bidang yang berada di bawah dan bertanggung jawab kepada kepala dinas;
  • Masing-masing Sub Bagian dipimpin oleh seorang Kepala Sub Bagian yang berada di bawah dan bertanggung jawab kepada Sekretaris;
  • Masing-masing Seksi dipimpin oleh seorang kepala Seksi yang berada di bawah dan bertanggung jawab kepada Kepala Bidang;
  • Kelompok Jabatan Fungsional dipimpin oleh seorang pejabat fungsional senior;
  • Kelompok Jabatan Fungsional dalam melaksanakan tugasnya berkoordinasi dengan unsur-unsur organisasi lainnya yang terkait serta berada di bawah dan bertanggung jawab kepada kepala dinas.

 

Pasal 23

 

Dalam melaksanakan tugasnya setiap pimpinan unit Organisasi dan Kelompok Jabatan Fungsional di Lingkungan Dinas Komunikasi dan Informatika wajib menerapkan prinsip koordinasi, integrasi dan sinkronisasi baik dalam lingkungan masing-masing maupun antar satuan organisasi.

 

Pasal 24

 

Setiap pimpinan  Satuan Organisasi di Lingkungan Dinas Komunikasi dan Informatika wajib mengawasi bawahannya masing-masing sesuai fungsi pengawasan melekat.

 

Pasal 25

 

Setiap pimpinan Satuan Organisasi di Lingkungan Dinas Komunikasi dan Informatika wajib mengikuti dan mematuhi petunjuk serta bertanggung jawab kepada atasan masing-masing.

 

Pasal 26

 

Pelimpahanwewenangdanpenunjukanpejabat yang mewakilipimpinan di LingkunganDinasKomunikasi dan Informatikadilaksanakanmenurutketentuansebagaiberikut:

(1)   Dalam hal Kepala Dinas berhalangan, Sekretaris melakukan tugas-tugas Kepala Dinas sesuai dengan peraturan perundang-undangan yang berlaku;

(2)   Dalam hal Sekretaris berhalangan, maka ditunjuk salah seorang Kepala Bidang sebagai pejabat yang mewakili Kepala Dinas dalam pelaksanaan tugas sehari-hari;

(3)   Dalam hal Sekretaris berhalangan, maka ditunjuk salah seorang Kepala Sub Bagian sebagai pejabat yang mewakili Sekretaris dalam pelaksanaan tugas sehari-hari;

(4)   Dalam hal Kepala Bidang berhalangan, maka ditunjuk salah seorang  Kepala Seksi sebagai pejabat yang mewakili Kepala Bidang dalam melaksanakan tugas sehari-hari.

 

Pasal 27

 

Pelimpahanwewenangdanpenunjukanpejabat yang mewakilipimpinan di LingkunganDinasKomunikasi dan Informatikasebagaimanadimaksudpadapasal26 di atasditetapkanberdasarkanperaturanperundang-undangan yang berlaku.

 

 

BAB IV

KETENTUAN PENUTUP

 

Pasal 28

 

Dengan berlakunya peraturan ini, maka semua ketentuan sebelumnya yang mengatur tentang uraian tugas unsur-unsur Organisasi Dinas Komunikasi dan Informatika dinyatakan tidak berlaku lagi.

 

Pasal  29

 

Hal-hal yang belum diatur dalam peraturan ini, akan diatur kemudian dengan Keputusan Bupati.

 

Pasal 30

 

Peraturan Bupati ini mulai berlaku pada tanggal diundangkan.

 

Agar setiap orang dapat mengetahuinya, memerintahkan pengundangan Peraturan Bupati ini dengan penempatannya dalam Berita Daerah Kabupaten Tanah Bumbu.

 

 

Ditetapkan di Batulicin

pada tanggal

BUPATI  TANAH  BUMBU,

 

 

 

 

MARDANI H. MAMING

 

Diundangkan di  Batulicin

pada tanggal

Plt SEKRETARIS DAERAH KABUPATEN TANAH BUMBU,

 

 

 

 

                   ERNO RUDI HANDOKO

 

BERITA DAERAH  KABUPATEN TANAH BUMBU

TAHUN  2016  NOMOR

 

 

Download